TB-500 10mg - Research-Grade Peptide
TB-500 10mg is supplied by Walker Chemicals as a research-grade peptide for laboratory research use only. It is provided in lyophilised powder form for controlled handling, storage, and analytical use in appropriate research environments.
TB-500 is commonly referenced in scientific literature in relation to actin-binding systems, cytoskeletal regulation, cellular migration models, extracellular matrix research, angiogenesis-related pathways, and tissue-remodelling investigations. It is frequently studied in controlled laboratory settings where researchers are examining peptide-mediated regulatory mechanisms and cellular-response models.
These research references are provided as scientific background only and do not alter the intended use of this product as a laboratory research material. This product is not supplied as a medicine, treatment, supplement, cosmetic, or personal-use product.
This product is intended for qualified research applications where product identity, consistency, and documentation are important.
Product Details
Name: TB-500 10mg
Catalogue Number: TB10
Chemical Formula: C212H350N56O78S
Molecular Weight: 4963.4 g/mol
Purity Level: >99%
Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Physical Form: Lyophilised Powder
Testing: Third-party lab report available where provided
Research Use
TB-500 is commonly studied in controlled laboratory settings involving actin-binding systems, cytoskeletal pathway models, cellular migration research, extracellular matrix systems, angiogenesis-related investigation, and tissue-remodelling models.
No medical, clinical, therapeutic, cosmetic, veterinary, dietary, wellness, performance, recovery, injury, wound-healing, tissue-repair, regenerative, or personal-use claims are made for this product.
Handling and Storage
TB-500 is supplied as a lyophilised powder to support stability during storage and handling. Store in a cool, dry environment away from direct light and moisture. For longer-term storage, refrigeration or freezer storage may be appropriate depending on laboratory protocols.
Researchers should follow suitable laboratory handling procedures and applicable safety guidance when working with peptide materials.
Quality and Documentation
Walker Chemicals aims to supply research-grade products with clear product information and quality-focused sourcing. Where available, third-party testing information may be provided to support product identification, transparency, and quality documentation.
Important Use Notice
TB-500 10mg is supplied strictly for laboratory research use only. It is not intended to diagnose, treat, cure, or prevent any disease or condition. It must not be administered to humans or animals under any circumstances. Product images are for illustrative purposes only. Actual vial appearance, label placement and packaging may vary by batch.